SKU: 94575585097

Human FGL1, hFc tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 23 - Aug 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FGL1, hFc tagProduct Specification Species Human Synonyms Fibrinogen like protein 1, HP 041, Hepassocin (HPS), Hepatocyte derived fibrinogen related protein 1 (HFREP 1), Liver fibrinogen related protein 1 (LFIRE 1), HFREP1 Accession Q08830 Amino Acid Sequence Protein sequence (Q08830, Leu23 Ile312, with C hFc tag)

Product Specification


Species Human
Synonyms Fibrinogen-like protein 1, HP-041, Hepassocin (HPS), Hepatocyte-derived fibrinogen-related protein 1 (HFREP-1), Liver fibrinogen-related protein 1 (LFIRE-1), HFREP1
Accession Q08830
Amino Acid Sequence

Protein sequence (Q08830, Leu23-Ile312, with C-hFc tag) LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Expression System HEK293
Molecular Weight

Predicted MW: 60.1 kDa Observed MW: 60 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Fibrinogen-like protein 1 (FGL-1) is a protein that is structurally related to fibrinogen. In humans, FGL-1 is encoded by the FGL1 gene. Four splice variants exist for this gene. FGL1 is a member of the fibrinogen family of proteins, which also includes fibrinogen, fibrinogen-like protein 2, and clotting factors V, VIII, and XIII. FGL-1 is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of that are common to all members of the fibrinogen family. However, FGL-1 lacks the platelet-binding site, cross-linking region, and thrombin-sensitive site which allow the other members of the fibrinogen family to aid in fibrin clot formation. FGL-1 has also been observed to strongly bind to and activate LAG-3, a regulatory protein expressed on T cells. As LAG-3 has an important role in controlling activated T cells, manipulating FGL-1 binding to T cells has been proposed for both cancer immunotherapy and anti-inflammatory treatments.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 94575585097

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
TIINSAT
Omaha, US
★★★★★ 5
Great dog toy
Color: Black & Yellow
Such fun toy. Excellent product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
A
Verified Purchase
Andrew Szeszycki
Cuba, US
★★★★★ 2
Not a chew toy.
Color: Black & Lake Blue
The inside it a hard plastic, my dog can’t chew it. Plastic on the outside is very durable, my dog likes the noise it makes and will chase it but loses interest fast. I will not buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
L
Verified Purchase
lisa kirby
Birmingham, US
★★★★★ 5
Durable
Color: Black & Yellow
The ball is durable and makes a sound that keeps my puppy interested in playing with it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
P
Verified Purchase
PikaJoon
Alexandria, US
★★★★★ 5
Haru LOVES this toy!
I recently purchased the Amazon Basics Hide and Seek Squeaky Dog Plush Toy, Rabbit and Carrot 5 Pack, and it has been an absolute hit with my dog Haru! This set has quickly become his favorite playtime activity, and it's easy to see why. From the moment I introduced Haru to the plush toys, he was hooked! The rabbit and carrot design is not only adorable but also adds an element of excitement and curiosity for him. The toys' quality is impressive, with sturdy stitching that has held up well to Haru's enthusiastic play style. The "hide and seek" aspect of the toys is brilliant. Each plush toy contains squeakers, which immediately captured Haru's attention. He thoroughly enjoys searching for the source of the squeaky sound and then triumphantly "catching" the rabbit or carrot. It's like a mini-game that keeps him mentally stimulated and entertained. One of the best things about this 5-pack set is the variety it offers. Haru never gets bored because he can alternate between the different plush toys, and each one presents a new challenge for him. Whether he's "hunting" the rabbit or "nibbling" on the carrot, his excitement is contagious! Furthermore, I appreciate how these toys keep Haru engaged for a good amount of time. As a busy dog owner, it's essential to have toys that can entertain him while I'm occupied with other tasks. The Hide and Seek Squeaky Dog Plush Toy accomplishes this perfectly, giving me some peace of mind knowing Haru is happily occupied.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 21, 2023
J
Verified Purchase
Jillian
Whiting, US
★★★★★ 5
Great toy
Great size for a medium to large dog and a good value overall. The carrot foliage is made of felt and can tear easily, but the carrot body and bunnies have typical toy durability. The bunnies include squeakers that are softer and not high-pitched. The holes are sized well—small enough that the bunnies don’t fall out on their own. Even with only a few stuffed inside, they stay put until your dog pulls them out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2025

recommand products